Monoclonal Antibody to MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)(Clone : 2F6), Clone: [2F6], Mouse

Artikelnummer: ABI-36-1423
Artikelname: Monoclonal Antibody to MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)(Clone : 2F6), Clone: [2F6], Mouse
Artikelnummer: ABI-36-1423
Hersteller Artikelnummer: 36-1423
Alternativnummer: ABI-36-1423-100UG
Hersteller: Abeomics
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Alternative Synonym: MAP3K1||MAPKKK1||MEKK||MEKK1
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NFkB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
Klonalität: Monoclonal
Klon-Bezeichnung: [2F6]
NCBI: 4214
UniProt: Q13233
Reinheit: Affinity Chromatography
Formulierung: Purified
Target-Kategorie: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1)
Application Verdünnung: Western Blot (1-2ug/ml),Immunohistochemistry (Formalin-fixed) (1-2ug/ml for 30 minutes at RT)(Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris Buffer with 1mM EDTA, pH 9.0, for 45 min at 95&degC followed by cooling at R