Anti-SMAD1/SMAD5 Picoband Antibody, Rabbit, Polyclonal
Artikelnummer:
ABT-ABO10105
| Artikelname: |
Anti-SMAD1/SMAD5 Picoband Antibody, Rabbit, Polyclonal |
| Artikelnummer: |
ABT-ABO10105 |
| Hersteller Artikelnummer: |
ABO10105 |
| Alternativnummer: |
ABT-ABO10105-100UG |
| Hersteller: |
Abcepta |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence of human SMAD1/SMAD5 (KRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEK). |
| Alternative Synonym: |
Mothers against decapentaplegic homolog 1, MAD homolog 1, Mothers against DPP homolog 1, JV4-1, Mad-related protein 1, SMAD family member 1, SMAD 1, Smad1, hSMAD1, Transforming growth factor-beta-signaling protein 1, BSP-1, SMAD1, BSP1, MADH1, MADR1 |
| Rabbit IgG polyclonal antibody for SMAD1/SMAD5 detection. Tested with WB in Human,Mouse,Rat. |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
52260 |
| NCBI: |
4086 |
| UniProt: |
Q15797 |
| Formulierung: |
Lyophilized |
| Antibody Type: |
Polyclonal Antibody |
| Anwendungsbeschreibung: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
