Anti-L1CAM antibody, Rabbit, Polyclonal
Artikelnummer:
ABT-ABO10106
| Artikelname: |
Anti-L1CAM antibody, Rabbit, Polyclonal |
| Artikelnummer: |
ABT-ABO10106 |
| Hersteller Artikelnummer: |
ABO10106 |
| Alternativnummer: |
ABT-ABO10106-100UG |
| Hersteller: |
Abcepta |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC-P |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence of human L1CAM (NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW). |
| Rabbit IgG polyclonal antibody for L1CAM detection. Tested with IHC-P in Human,Mouse,Rat. |
| Klonalität: |
Polyclonal |
| UniProt: |
A00729-1 |
| Formulierung: |
Lyophilized |
| Antibody Type: |
Polyclonal Antibody |
| Anwendungsbeschreibung: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
