Anti-MVD Picoband Antibody, Rabbit, Polyclonal
Artikelnummer:
ABT-ABO10201
| Artikelname: |
Anti-MVD Picoband Antibody, Rabbit, Polyclonal |
| Artikelnummer: |
ABT-ABO10201 |
| Hersteller Artikelnummer: |
ABO10201 |
| Alternativnummer: |
ABT-ABO10201-100UG |
| Hersteller: |
Abcepta |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence of human MVD (KDFTEDRIWLNGREEDVGQPRLQACLREIRCLARKRR). |
| Alternative Synonym: |
Diphosphomevalonate decarboxylase, 4.1.1.33, Mevalonate (diphospho)decarboxylase, MDDase, Mevalonate pyrophosphate decarboxylase, MVD, MPD |
| Rabbit IgG polyclonal antibody for MVD detection. Tested with WB in Human,Mouse,Rat. |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
43405 |
| NCBI: |
4597 |
| UniProt: |
P53602 |
| Formulierung: |
Lyophilized |
| Antibody Type: |
Polyclonal Antibody |
| Anwendungsbeschreibung: |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
