GLI3 Antibody
Artikelnummer:
ASB-ARP32317_P050
- Bilder (3)
| Artikelname: | GLI3 Antibody |
| Artikelnummer: | ASB-ARP32317_P050 |
| Hersteller Artikelnummer: | ARP32317_P050 |
| Alternativnummer: | ASB-ARP32317_P050-25UL,ASB-ARP32317_P050-100UL |
| Hersteller: | Aviva |
| Wirt: | Rabbit |
| Kategorie: | Proteine/Peptide |
| Applikation: | IHC |
| Spezies Reaktivität: | Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
| Immunogen: | The immunogen is a synthetic peptide directed towards the following sequence KPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYETNCHWEGC |
| Alternative Synonym: | PHS, ACLS, GCPS, PAPA, PAPB, PAP-A, PAPA1, PPDIV, GLI3FL, GLI3-190 |
| This gene encodes a protein which belongs to the C2H2-type zinc finger proteins subclass of the Gli family. They are characterized as DNA-binding transcription factors and are mediators of Sonic hedgehog (Shh) signaling. The protein encoded by this gene localizes in the cytoplasm and activates patched Drosophila homolog (PTCH) gene expression. It is also thought to play a role during embryogenesis. Mutations in this gene have been associated with several diseases, including Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome, preaxial polydactyly type IV, and postaxial polydactyly types A1 and B. |
|
|
Rabbit Anti-GLI3 antibody Catalog Number: ARP32317 Formalin Fixed Paraffin Embedded Tissue: Human Lung Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
Rabbit Anti-GLI3 antibody Catalog Number: ARP32317 Formalin Fixed Paraffin Embedded Tissue: Human Testis Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec |
|
|
GLI3 Antibody (ARP32317_P050) in Human Lung using Immunohistochemistry |
Produktgarantie und fachkundiger Support
