Anti-SARS-CoV-2 ORF8 Antibody HRP Conjugated, Rabbit, Polyclonal

Artikelnummer: BOB-A33995-HRP
Artikelname: Anti-SARS-CoV-2 ORF8 Antibody HRP Conjugated, Rabbit, Polyclonal
Artikelnummer: BOB-A33995-HRP
Hersteller Artikelnummer: A33995-HRP
Alternativnummer: BOB-A33995-HRP-100UG
Hersteller: Boster Bio
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC, WB
Spezies Reaktivität: Human
Immunogen: AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
Alternative Synonym: ORF8 protein, ORF8, Non-structural protein 8, ns8
Klonalität: Polyclonal
Molekulargewicht: Calculated Molecular Weight: 16693 MW
NCBI: 43740577
UniProt: P0DTC8
Puffer: Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4.
Reinheit: Immunogen affinity purified.
Formulierung: Liquid
Target-Kategorie: ORF8 protein
Application Verdünnung: Western blot, Optimal dilutions should be determined by end users. Immunohistochemistry (Paraffin-embedded Section), Optimal dilutions should be determined by end users. ELISA, Optimal dilutions should be determined by end users.