Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial (Active)

Artikelnummer: BYT-ORB1095895
Artikelname: Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial (Active)
Artikelnummer: BYT-ORB1095895
Hersteller Artikelnummer: orb1095895
Alternativnummer: BYT-ORB1095895-20,BYT-ORB1095895-100,BYT-ORB1095895-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
This Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial (Active) spans the amino acid sequence from region 22-211aa. Purity: Greater than 94% as determined by SDS-PAGE.
Molekulargewicht: 50.1 kDa
UniProt: P19438
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 94% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized TNF-alpha at 5 µg/ml can bind human TNFR1, the EC50 is 7.799-10.90 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 µg/ml can bind human TNFR1, the EC50 is 4.409-6.797 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized TNF-alpha at 5 µg/ml can bind human TNFR1, the EC50 is 7.799-10.90 ng/ml.
Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 µg/ml can bind human TNFR1, the EC50 is 4.409-6.797 ng/ml.