Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4), partial (Active)
Artikelnummer:
BYT-ORB1095906
- Bilder (3)
| Artikelname: | Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4), partial (Active) |
| Artikelnummer: | BYT-ORB1095906 |
| Hersteller Artikelnummer: | orb1095906 |
| Alternativnummer: | BYT-ORB1095906-20,BYT-ORB1095906-100,BYT-ORB1095906-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4) (CD_antigen: CD152) (CD152) |
| This Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4), partial (Active) spans the amino acid sequence from region 37-162aa. Purity: Greater than 91% as determined by SDS-PAGE. |
| Molekulargewicht: | 42.5 kDa |
| UniProt: | P16410 |
| Puffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 91% as determined by SDS-PAGE. |
| Formulierung: | Lyophilized powder |
| Sequenz: | AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized CD152 at 2 µg/ml can bind Anti-CD152 rabbit monoclonal antibody, the EC50 of human CD152 protein is 27.14-34.82 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |



