Human ANGPT2 Protein
Artikelnummer:
BYT-ORB1477846
- Bilder (3)
| Artikelname: | Human ANGPT2 Protein |
| Artikelnummer: | BYT-ORB1477846 |
| Hersteller Artikelnummer: | orb1477846 |
| Alternativnummer: | BYT-ORB1477846-1,BYT-ORB1477846-100,BYT-ORB1477846-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (ANG-2) |
| This Human ANGPT2 Protein spans the amino acid sequence from region 19-496aa. Purity: Greater than 92% as determined by SDS-PAGE. |
| Molekulargewicht: | 56.3 kDa |
| UniProt: | O15123 |
| Puffer: | Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 92% as determined by SDS-PAGE. |
| Formulierung: | Lyophilized powder |
| Sequenz: | YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTV |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human ANGPT2 at 2 µg/mL can bind anti-ANGPT2 recombinant antibody, the EC50 is 0.6666-0.8876 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Measured by its binding ability in a functional ELISA. Immobilized Human ANGPT2 at 2 µg/ml can bind anti-ANGPT2 recombinant antibody, the EC50 is 0.6666-0.8876 ng/mL. |
|
|
The purity of ANGPT2 was greater than 90% as determined by SEC-HPLC |
Produktgarantie und fachkundiger Support
