Human CCR4-VLPs Protein
Artikelnummer:
BYT-ORB1478131
- Bilder (3)
| Artikelname: | Human CCR4-VLPs Protein |
| Artikelnummer: | BYT-ORB1478131 |
| Hersteller Artikelnummer: | orb1478131 |
| Alternativnummer: | BYT-ORB1478131-1,BYT-ORB1478131-100,BYT-ORB1478131-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | K5-5 CD_antigen, CD194 |
| This Human CCR4-VLPs Protein spans the sequence from region 1-360aa. |
| Molekulargewicht: | 43.2 kDa |
| UniProt: | P51679 |
| Puffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Quelle: | Homo sapiens (Human) |
| Formulierung: | Lyophilized powder |
| Sequenz: | MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVVVLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVGFYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYTERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKAVKMIFAVVVLFLGFW |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CCR4 at 10 µg/mL can bind Anti-CCR4 recombinant antibody, the EC50 is 362.3-630.8 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing |
|
|
Detected by Mouse anti-6*His monoclonal antibody. |
|
|
Measured by its binding ability in a functional ELISA. Immobilized Human CCR4 at 10 µg/ml can bind Anti-CCR4 recombinant antibody, the EC50 is 362.3-630.8 ng/mL. |
|
|
The presence of VLP-like structures was confirmed by TEM |
Produktgarantie und fachkundiger Support
