Human Complement C3 Protein
Artikelnummer:
BYT-ORB1478159
- Bilder (3)
| Artikelname: | Human Complement C3 Protein |
| Artikelnummer: | BYT-ORB1478159 |
| Hersteller Artikelnummer: | orb1478159 |
| Alternativnummer: | BYT-ORB1478159-1,BYT-ORB1478159-100,BYT-ORB1478159-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1 |
| This Human Complement C3 Protein spans the amino acid sequence from region 26-225aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 26.4 kDa |
| UniProt: | P01024 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | YSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |



