Human CT83 protein
Artikelnummer:
BYT-ORB54585
- Bilder (3)
| Artikelname: | Human CT83 protein |
| Artikelnummer: | BYT-ORB54585 |
| Hersteller Artikelnummer: | orb54585 |
| Alternativnummer: | BYT-ORB54585-20,BYT-ORB54585-100,BYT-ORB54585-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Cancer/testis antigen 83 |
| This Human CT83 protein spans the amino acid sequence from region 1-113aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 26.8 kDa |
| UniProt: | Q5H943 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-tagged: N-terminal 6xHis-B2M-tagged1-113AA: 1-113AAFull Length: Full Length |



