Mouse Amh protein
Artikelnummer:
BYT-ORB54604
- Bilder (3)
| Artikelname: | Mouse Amh protein |
| Artikelnummer: | BYT-ORB54604 |
| Hersteller Artikelnummer: | orb54604 |
| Alternativnummer: | BYT-ORB54604-20,BYT-ORB54604-100,BYT-ORB54604-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Anti-Muellerian hormone |
| This Mouse Amh protein spans the amino acid sequence from region 450-552aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 11.3 kDa |
| UniProt: | P27106 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mus musculus (Mouse) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC |
| Anwendungsbeschreibung: | Biological Origin: Mus musculus (Mouse). Application Notes: NO-tagged: NO-tagged287-832AA: 450-552AAPartial: Partial |



