human DSG1 protein

Artikelnummer: BYT-ORB54740
Artikelname: human DSG1 protein
Artikelnummer: BYT-ORB54740
Hersteller Artikelnummer: orb54740
Alternativnummer: BYT-ORB54740-20,BYT-ORB54740-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cadherin family member 4 Desmosomal glycoprotein 1
This human DSG1 protein spans the amino acid sequence from region 50-548aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 60.4 kDa
UniProt: Q02413
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EWIKFAAACREGEDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVTPFFIIYCRALNSMGQDLERPLELRVRVLDINDNPPVFSMATFAGQIEENSNANTLVMILNATDADEPNNLNSKIAFKIIRQEPSDSPMFIINRNTGEIRTMNNFLDREQYGQYALAVRGSDRDGGADGMSAECECNIKILDVNDNIPYMEQSSYTIEIQENTLNSNLLEIRVIDLDEEFSANWM
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged: N-terminal 10xHis-tagged and C-terminal Myc-tagged50-548AA: 50-548AAExtracellular Domain: Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) DSG1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) DSG1.