Human FCRL6 protein
Artikelnummer:
BYT-ORB595094
- Bilder (3)
| Artikelname: | Human FCRL6 protein |
| Artikelnummer: | BYT-ORB595094 |
| Hersteller Artikelnummer: | orb595094 |
| Alternativnummer: | BYT-ORB595094-20,BYT-ORB595094-100,BYT-ORB595094-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Fc receptor homolog 6 (FcRH6) (IFGP6) |
| This Human FCRL6 protein spans the amino acid sequence from region 20-307aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molekulargewicht: | 34.2 kDa |
| UniProt: | Q6DN72 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNY |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Application Notes: Extracellular Domain |



