Human DDX5 protein

Artikelnummer: BYT-ORB604045
Artikelname: Human DDX5 protein
Artikelnummer: BYT-ORB604045
Hersteller Artikelnummer: orb604045
Alternativnummer: BYT-ORB604045-1,BYT-ORB604045-100,BYT-ORB604045-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: DEAD box protein 5 (RNA helicase p68 G17P1) (HELR) (HLR1)
This Human DDX5 protein spans the amino acid sequence from region 1-614aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 74.1 kDa
UniProt: P17844
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLD
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) DDX5.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) DDX5.