Human EpCAM protein

Artikelnummer: BYT-ORB604071
Artikelname: Human EpCAM protein
Artikelnummer: BYT-ORB604071
Hersteller Artikelnummer: orb604071
Alternativnummer: BYT-ORB604071-1,BYT-ORB604071-100,BYT-ORB604071-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein Short name, EGP Epithelial glycoprotein 314 Short name, EGP314 Short name, hEGP314 KS 1/4 antigen KSA Major gastrointestinal tumor-associated protein GA733-2 Tumor-associated calcium signal transducer 1 CD_antigen, CD326
This Human EpCAM protein spans the amino acid sequence from region 24-265aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 40.4 kDa
UniProt: P16422
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) EPCAM.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) EPCAM.