Rat CD106 protein

Artikelnummer: BYT-ORB604447
Artikelname: Rat CD106 protein
Artikelnummer: BYT-ORB604447
Hersteller Artikelnummer: orb604447
Alternativnummer: BYT-ORB604447-1,BYT-ORB604447-100,BYT-ORB604447-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: CD106
This Rat CD106 protein spans the amino acid sequence from region 31-697aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 77.4 kDa
UniProt: P29534
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: PEYKTLAQIGDSMLLTCSTTGCESPSFSWRTQIDSPLNGKVKTEGAKSVLTMDPVSFENEHSYLCTATCNSGKLERGIQVDIYSFPKDPEIQFSGPLEVGKPVMVKCLAPDVYPIDRLEIELFKGDRLMKKQDFVDEMAKKSLETKSLEVIFTPVIEDIEKALVCRAKLYIDQTDSIPKERETVRELQVYTSPKNTEISVHPSTRLHEGAAVTMTCASEGLPAPEIFWSKKLDNGVLQLLSGNATLTLIAMRMED
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Vcam1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Vcam1.