E. coli fliC protein

Artikelnummer: BYT-ORB604505
Artikelname: E. coli fliC protein
Artikelnummer: BYT-ORB604505
Hersteller Artikelnummer: orb604505
Alternativnummer: BYT-ORB604505-1,BYT-ORB604505-100,BYT-ORB604505-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: fliC, flaF, hag, b1923, JW1908Flagellin
This E. coli fliC protein spans the amino acid sequence from region 2-498aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 51.2 kDa
UniProt: P04949
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli (strain K12)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AQVINTNSLSLITQNNINKNQSALSSSIERLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQAARNANDGISVAQTTEGALSEINNNLQRVRELTVQATTGTNSESDLSSIQDEIKSRLDEIDRVSGQTQFNGVNVLAKNGSMKIQVGANDNQTITIDLKQIDAKTLGLDGFSVKNNDTVTTSAPVTAFGATTTNNIKLTGITLSTEAATDTGGTNPASIEGVYTDNGNDYYAKITGGDNDGKYYAVTVANDGTV
Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) fliC.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) fliC.