Virus SSA1 protein
Artikelnummer:
BYT-ORB604574
- Bilder (3)
| Artikelname: | Virus SSA1 protein |
| Artikelnummer: | BYT-ORB604574 |
| Hersteller Artikelnummer: | orb604574 |
| Alternativnummer: | BYT-ORB604574-1,BYT-ORB604574-100,BYT-ORB604574-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Heat shock protein YG100 |
| This Virus SSA1 protein spans the amino acid sequence from region 443-642aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molekulargewicht: | 28.3 kDa |
| UniProt: | P10591 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast) |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | ERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEAGDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQAGGAPGGAAGGAPGGFPGGAPPAPEAEGPTVEEVD |
| Anwendungsbeschreibung: | Biological Origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Application Notes: Partial |



