E. coli ompC protein

Artikelnummer: BYT-ORB604724
Artikelname: E. coli ompC protein
Artikelnummer: BYT-ORB604724
Hersteller Artikelnummer: orb604724
Alternativnummer: BYT-ORB604724-1,BYT-ORB604724-100,BYT-ORB604724-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Outer membrane protein 1BPorin OmpC
This E. coli ompC protein spans the amino acid sequence from region 22-367aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 38.3 kDa
UniProt: P06996
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli (strain K12)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANK
Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) ompC.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) ompC.