Human ADAMTS18 protein

Artikelnummer: BYT-ORB605079
Artikelname: Human ADAMTS18 protein
Artikelnummer: BYT-ORB605079
Hersteller Artikelnummer: orb605079
Alternativnummer: BYT-ORB605079-1,BYT-ORB605079-100,BYT-ORB605079-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ADAMTS21
This Human ADAMTS18 protein spans the amino acid sequence from region 942-1047aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 15.5 kDa
UniProt: Q8TE60
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQEGCVLGR
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ADAMTS18.