Bacteria KMP-11 protein

Artikelnummer: BYT-ORB605143
Artikelname: Bacteria KMP-11 protein
Artikelnummer: BYT-ORB605143
Hersteller Artikelnummer: orb605143
Alternativnummer: BYT-ORB605143-1,BYT-ORB605143-100,BYT-ORB605143-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: KMP11
This Bacteria KMP-11 protein spans the amino acid sequence from region 1-92aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 18.0 kDa
UniProt: Q9U6Z1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Trypanosoma cruzi
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAKFAELLEQQKNAQFPGK
Anwendungsbeschreibung: Biological Origin: Trypanosoma cruzi. Application Notes: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Trypanosoma cruziKMP-11.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Trypanosoma cruziKMP-11.