Bacteria KMP-11 protein
Artikelnummer:
BYT-ORB605143
- Bilder (3)
| Artikelname: | Bacteria KMP-11 protein |
| Artikelnummer: | BYT-ORB605143 |
| Hersteller Artikelnummer: | orb605143 |
| Alternativnummer: | BYT-ORB605143-1,BYT-ORB605143-100,BYT-ORB605143-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | KMP11 |
| This Bacteria KMP-11 protein spans the amino acid sequence from region 1-92aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molekulargewicht: | 18.0 kDa |
| UniProt: | Q9U6Z1 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Trypanosoma cruzi |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAKFAELLEQQKNAQFPGK |
| Anwendungsbeschreibung: | Biological Origin: Trypanosoma cruzi. Application Notes: Full Length |



