Rat Mertk protein
Artikelnummer:
BYT-ORB605234
- Bilder (3)
| Artikelname: | Rat Mertk protein |
| Artikelnummer: | BYT-ORB605234 |
| Hersteller Artikelnummer: | orb605234 |
| Alternativnummer: | BYT-ORB605234-1,BYT-ORB605234-100,BYT-ORB605234-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Proto-oncogene c-Mer (Receptor tyrosine kinase MerTK) |
| This Rat Mertk protein spans the amino acid sequence from region 19-497aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 55.5 kDa |
| UniProt: | P57097 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Rattus norvegicus (Rat) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | GGTAEKEEEIKPDQPFSGPLPGSLPADHRPFFAPHSSGDQLSPSQTGRSHPAHTATPQMTSAASNLLPPVAFKNTIGRIVLSEHKSVKFNCSINIPNVYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSITSVQRSDNGSYICKMKVNDREVVSDPIYVEVQGLPYFTKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNENPERSPSVLTVAGLTETAVFSCEAHNDKGLTVSKGVQI |
| Anwendungsbeschreibung: | Biological Origin: Rattus norvegicus (Rat). Application Notes: Partial |



