Plant Viscum album Beta-galactoside-specific lectin 1 protein
Artikelnummer:
BYT-ORB605408
- Bilder (3)
| Artikelname: | Plant Viscum album Beta-galactoside-specific lectin 1 protein |
| Artikelnummer: | BYT-ORB605408 |
| Hersteller Artikelnummer: | orb605408 |
| Alternativnummer: | BYT-ORB605408-1,BYT-ORB605408-100,BYT-ORB605408-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Beta-galactoside-specific lectin I Viscumin |
| This Plant Viscum album Beta-galactoside-specific lectin 1 protein spans the amino acid sequence from region 34-287aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 30.4 kDa |
| UniProt: | P81446 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Viscum album (European mistletoe) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | YERLRLRVTHQTTGEEYFRFITLLRDYVSSGSFSNEIPLLRQSTIPVSDAQRFVLVELTNEGGDSITAAIDVTNLYVVAYQAGDQSYFLRDAPRGAETHLFTGTTRSSLPFNGSYPDLERYAGHRDQIPLGIDQLIQSVTALRFPGGSTRTQARSILILIQMISEAARFNPILWRARQYINSGASFLPDVYMLELETSWGQQSTQVQQSTDGVFNNPIRLAIPPGNFVTLTNVRDVIASLAIMLFVCGERPSSS |
| Anwendungsbeschreibung: | Biological Origin: Viscum album (European mistletoe). Application Notes: Partial |



