Polyclonal Rabbit anti-Human POLR2L Antibody (IHC, IF, WB) LS-C335249

Artikelnummer: LS-C335249-100
Artikelname: Polyclonal Rabbit anti-Human POLR2L Antibody (IHC, IF, WB) LS-C335249
Artikelnummer: LS-C335249-100
Hersteller Artikelnummer: LS-C335249-100
Alternativnummer: LS-C335249-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-67 of human POLR2L (NP_066951.1). MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Konjugation: Unconjugated
Alternative Synonym: POLR2L, RBP10, RPABC5, RPB10, RPB7.6, RPB10 homolog, RPB10beta, HRPB7.6, HsRPB10b
POLR2L antibody LS-C335249 is an unconjugated rabbit polyclonal antibody to POLR2L from human. It is reactive with mouse and rat. Validated for IF, IHC and WB.
Klonalität: Polyclonal
NCBI: 5441
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 7kDa, while the observed MW by Western blot was Refer to Figures.
Western blot analysis of extracts of Raji cells.
Immunohistochemistry of paraffin-embedded rat brain tissue.
Immunofluorescence analysis of HeLa cells.