Synthetic peptide corresponding to aa62-100, SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP of human TIP 39, conjugated to KLH.
Applications: Suitable for use in ELISA, Immunohistochemistry and RIA. Other applications not tested. Recommended Dilutions: ELISA: 1:4000 RIA: 1:2000 Immunohistochemistry (Paraffin): 1:100 Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
