TIP 39 (Tuberoinfundibular Peptide of 39 Residues) (Not for Export EU), Rabbit

Artikelnummer: USB-T5499-87B
Artikelname: TIP 39 (Tuberoinfundibular Peptide of 39 Residues) (Not for Export EU), Rabbit
Artikelnummer: USB-T5499-87B
Hersteller Artikelnummer: T5499-87B
Alternativnummer: USB-T5499-87B-20, USB-T5499-87B-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, RIA
Immunogen: Synthetic human TIP 39 (aa 62-100) bTG conjugated (SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP)
Tuberoinfundibular peptide of 39 residues is a protein that in humans is encoded by the PTH2 gene.[1][2]. TIP39 is related to parathyroid hormone (PTH, MIM 168450) and PTH-related protein (PTHRP, MIM 168470) and is a ligand for PTH receptor-2 (PTHR2, MIM 601469) (John et al., 2002).[supplied by OMIM][2] Applications: Suitable for use in ELISA, RIA. Other applications not tested. Recommended Dilution: ELISA: 1:4000 RIA: 1:2000 Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized powder may be stored at 4C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20C. Reconstituted product is stable for 12 months at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Reinheit: Serum
Formulierung: Supplied as a lyophilized powder in PBS pH 7.2.