CD31/PECAM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A0378
Article Name: CD31/PECAM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A0378
Supplier Catalog Number: A0378
Alternative Catalog Number: ABB-A0378-20UL,ABB-A0378-100UL,ABB-A0378-500UL,ABB-A0378-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CD31, PECA1, GPIIA, PECAM-1, endoCAM, CD31/EndoCAM
The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.
Clonality: Polyclonal
Molecular Weight: 83 kDa
NCBI: 5175
UniProt: P16284
Purity: Affinity purification
Sequence: AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
Target: PECAM1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:5000|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor immunology,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors,Mesenchymal Stem Cells,Cardiovascular,Angiogenesis,Blood. Shipping: Ice Bag
Western blot analysis of various lysates using CD31/PECAM1 Rabbit pAb (A0378) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of lysates from U-937 cells, using CD31/PECAM1 Rabbit pAb (A0378) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
Western blot analysis of lysates from THP-1 cells, using CD31/PECAM1 Rabbit pAb (A0378) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Human liver cancer using CD31/PECAM1 Rabbit pAb (A0378) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human placenta using CD31/PECAM1 Rabbit pAb (A0378) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of Human placenta tissue using CD31/PECAM1 Rabbit pAb (A0378) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.
Immunofluorescence analysis of Human placenta tissue using CD31/PECAM1 Rabbit pAb (A0378) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.