EMR2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14278
- Images (1)
| Article Name: | EMR2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A14278 |
| Supplier Catalog Number: | A14278 |
| Alternative Catalog Number: | ABB-A14278-100UL,ABB-A14278-20UL,ABB-A14278-1000UL,ABB-A14278-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | VBU, CD97, EMR2, CD312 |
| This gene encodes a member of the class B seven-span transmembrane (TM7) subfamily of G-protein coupled receptors. These proteins are characterized by an extended extracellular region with a variable number of N-terminal epidermal growth factor-like domains coupled to a TM7 domain via a mucin-like spacer domain. The encoded protein is expressed mainly in myeloid cells where it promotes cell-cell adhesion through interaction with chondroitin sulfate chains. This gene is situated in a cluster of related genes on chromosome 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 90kDa |
| NCBI: | 30817 |
| UniProt: | Q9UHX3 |
| Purity: | Affinity purification |
| Sequence: | TIQSILQALDELLEAPGDLETLPRLQQHCVASHLLDGLEDVLRGLSKNLSNGLLNFSYPAGTELSLEVQKQVDRSVTLRQNQAVMQLDWNQAQKSGDPGPSVVGLVSIPGMGKLLAEAPLVLEPEKQMLLHETHQGLLQDGSPILLSDVISAFLSNNDTQNLSSPVTFTFSHRSVIPRQKVLCVFWEHGQNGCGHWATTGC |
| Target: | ADGRE2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Immunology Inflammation,CDs. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using EMR2 Rabbit pAb (A14278) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
