NOL12 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14292
Article Name: NOL12 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14292
Supplier Catalog Number: A14292
Alternative Catalog Number: ABB-A14292-100UL,ABB-A14292-20UL,ABB-A14292-1000UL,ABB-A14292-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Nop25, dJ37E16.7, NOL12
Enables identical protein binding activity. Predicted to be active in nucleolus.
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 79159
UniProt: Q9UGY1
Purity: Affinity purification
Sequence: MGRNKKKKRDGDDRRPRLVLSFDEEKRREYLTGFHKRKVERKKAAIEEIKQRLKEEQRKLREERHQEYLKMLAEREEALEEADELDRLVTAKTESVQYDHPNHTVTVTTISDLDLSGARLLGLTPPEGGAGDRSEEEASSTEKPTKALPRKSRDPLLSQRISSLTASLHAHSRKKVKRKHPRRAQDSKKPPRAPRTSKAQRRRLTGKARHSGE
Target: NOL12
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag
Western blot analysis of various lysates using NOL12 Rabbit pAb (A14292) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.