ADH1B Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A1431
- Images (1)
| Article Name: | ADH1B Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A1431 |
| Supplier Catalog Number: | A1431 |
| Alternative Catalog Number: | ABB-A1431-20UL,ABB-A1431-100UL,ABB-A1431-1000UL,ABB-A1431-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | ADH2, HEL-S-117, ADH1B |
| The protein encoded by this gene is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This encoded protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. Two transcript variants encoding different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 40kDa |
| NCBI: | 125 |
| UniProt: | P00325 |
| Purity: | Affinity purification |
| Sequence: | LSAVMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTVLTF |
| Target: | ADH1B |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases Markers,Other Neurological disorders. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from rat liver, using ADH1B Rabbit pAb (A1431) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
