NECAP2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14346
Article Name: NECAP2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14346
Supplier Catalog Number: A14346
Alternative Catalog Number: ABB-A14346-20UL,ABB-A14346-100UL,ABB-A14346-500UL,ABB-A14346-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: NECAP2
This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described.
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 55707
UniProt: Q9NVZ3
Purity: Affinity purification
Sequence: GKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF
Target: NECAP2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using NECAP2 Rabbit pAb (A14346) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.