RNASE3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14489
Article Name: RNASE3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14489
Supplier Catalog Number: A14489
Alternative Catalog Number: ABB-A14489-20UL,ABB-A14489-100UL,ABB-A14489-1000UL,ABB-A14489-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ECP, RAF1, RNS3, RNASE3
The protein encoded by this gene belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein exhibits antimicrobial activity against pathogenic bacteria
Clonality: Polyclonal
Molecular Weight: 18kDa
NCBI: 6037
UniProt: P12724
Purity: Affinity purification
Sequence: RSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI
Target: RNASE3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using RNASE3 Rabbit pAb (A14489) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.