NGDN Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14509
- Images (1)
| Article Name: | NGDN Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A14509 |
| Supplier Catalog Number: | A14509 |
| Alternative Catalog Number: | ABB-A14509-100UL,ABB-A14509-20UL,ABB-A14509-500UL,ABB-A14509-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | NGD, LCP5, CANu1, lpd-2, C14orf120, NGDN |
| Neuroguidin is an EIF4E (MIM 133440)-binding protein that interacts with CPEB (MIM 607342) and functions as a translational regulatory protein during development of the vertebrate nervous system (Jung et al., 2006 [PubMed 16705177]). |
| Clonality: | Polyclonal |
| Molecular Weight: | 36kDa |
| NCBI: | 25983 |
| UniProt: | Q8NEJ9 |
| Purity: | Affinity purification |
| Sequence: | LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIREL |
| Target: | NGDN |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using NGDN Rabbit pAb (A14509) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
Product Guarantee and Expert Support
