TSHB Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14523
Article Name: TSHB Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14523
Supplier Catalog Number: A14523
Alternative Catalog Number: ABB-A14523-20UL,ABB-A14523-100UL,ABB-A14523-1000UL,ABB-A14523-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TSH-B, TSH-BETA, TSHB
The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. Thyroid stimulating hormone functions in the control of thyroid structure and metabolism. The protein encoded by this gene is the beta subunit of thyroid stimulating hormone. Mutations in this gene are associated with congenital central and secondary hypothyroidism and Hashimotos thyroiditis. Alternative splicing of this gene results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 7252
UniProt: P01222
Purity: Affinity purification
Sequence: YCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV
Target: TSHB
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using TSHB Rabbit pAb (A14523) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.