Cyclin A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14529
Article Name: Cyclin A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14529
Supplier Catalog Number: A14529
Alternative Catalog Number: ABB-A14529-100UL,ABB-A14529-20UL,ABB-A14529-500UL,ABB-A14529-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CT146, Cyclin A1
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. The cyclin encoded by this gene was shown to be expressed in testis and brain, as well as in several leukemic cell lines, and is thought to primarily function in the control of the germline meiotic cell cycle. This cyclin binds both CDK2 and CDC2 kinases, which give two distinct kinase activities, one appearing in S phase, the other in G2, and thus regulate separate functions in cell cycle. This cyclin was found to bind to important cell cycle regulators, such as Rb family proteins, transcription factor E2F-1, and the p21 family proteins. Multiple transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 8900
UniProt: P78396
Purity: Affinity purification
Sequence: YLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYL
Target: CCNA1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Endocrine Metabolism,AMPK Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using Cyclin A1 Rabbit pAb (A14529) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.