CFAP44 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14539
- Images (1)
| Article Name: | CFAP44 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A14539 |
| Supplier Catalog Number: | A14539 |
| Alternative Catalog Number: | ABB-A14539-20UL,ABB-A14539-100UL,ABB-A14539-500UL,ABB-A14539-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | WDR52, SPGF20, CFAP44 |
| Enables peptidase activity. Involved in sperm axoneme assembly. Acts upstream of or within microtubule cytoskeleton organization. Predicted to be located in cytoplasm, cytoskeleton, and motile cilium. Implicated in spermatogenic failure 20. |
| Clonality: | Polyclonal |
| Molecular Weight: | 214kDa |
| NCBI: | 55779 |
| UniProt: | Q96MT7 |
| Purity: | Affinity purification |
| Sequence: | SSSGEGIGVIGVHPHKTYFTVAEKGSFPDIIIYEYPSLRPYRVLRDGTEKGYAYVDFNYSGNLLASVGSNPDYTLTIWNWKEEQPILRTKAFSQEVFKVTFNPDKEEQLTTSGSGHIKFWEMAFTFTGLKLQGSLGRFGKTITTDIEGYMELPDGKVLSGSEWGNMLLWEGGLIKVELCRGTSKSCHNGPI |
| Target: | CFAP44 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CFAP44 Rabbit pAb (A14539) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 90s. |
Product Guarantee and Expert Support
