SLC47A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14559
Article Name: SLC47A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14559
Supplier Catalog Number: A14559
Alternative Catalog Number: ABB-A14559-20UL,ABB-A14559-100UL,ABB-A14559-500UL,ABB-A14559-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MATE1, SLC47A1
This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 55244
UniProt: Q96FL8
Purity: Affinity purification
Sequence: LNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQLVLRRGLLL
Target: SLC47A1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Drug metabolism. Shipping: Ice Bag
Western blot analysis of lysates from rat liver, using SLC47A1 Rabbit pAb (A14559) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.