SLC26A2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14561
Article Name: SLC26A2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14561
Supplier Catalog Number: A14561
Alternative Catalog Number: ABB-A14561-20UL,ABB-A14561-100UL,ABB-A14561-1000UL,ABB-A14561-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DTD, EDM4, DTDST, MST153, D5S1708, MSTP157, SLC26A2
The diastrophic dysplasia sulfate transporter is a transmembrane glycoprotein implicated in the pathogenesis of several human chondrodysplasias. It apparently is critical in cartilage for sulfation of proteoglycans and matrix organization.
Clonality: Polyclonal
Molecular Weight: 82kDa
NCBI: 1836
UniProt: P50443
Purity: Affinity purification
Sequence: MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNILGD
Target: SLC26A2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using SLC26A2 Rabbit pAb (A14561) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.