JunB Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14566
- Images (1)
| Article Name: | JunB Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A14566 |
| Supplier Catalog Number: | A14566 |
| Alternative Catalog Number: | ABB-A14566-100UL,ABB-A14566-20UL,ABB-A14566-500UL,ABB-A14566-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | AP-1, JunB |
| Enables sequence-specific double-stranded DNA binding activity. Involved in positive regulation of transcription by RNA polymerase II. Located in nucleoplasm. Part of transcription factor AP-1 complex. Biomarker of Hodgkins lymphoma and anaplastic large cell lymphoma. |
| Clonality: | Polyclonal |
| Molecular Weight: | 36kDa |
| NCBI: | 3726 |
| UniProt: | P17275 |
| Purity: | Affinity purification |
| Sequence: | MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGA |
| Target: | JUNB |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using JunB Rabbit pAb (A14566) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
