CAP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14577
Article Name: CAP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14577
Supplier Catalog Number: A14577
Alternative Catalog Number: ABB-A14577-20UL,ABB-A14577-100UL,ABB-A14577-1000UL,ABB-A14577-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CAP, CAP1-PEN, CAP1
The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin. Alternatively spliced transcript variants encoding different isoforms have been identified.
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 10487
UniProt: Q01518
Purity: Affinity purification
Sequence: MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENK
Target: CAP1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix. Shipping: Ice Bag
Western blot analysis of various lysates using CAP1 Rabbit pAb (A14577) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.