ZNF621 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14634
Article Name: ZNF621 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14634
Supplier Catalog Number: A14634
Alternative Catalog Number: ABB-A14634-100UL,ABB-A14634-20UL,ABB-A14634-500UL,ABB-A14634-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ZNF621
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 285268
UniProt: Q6ZSS3
Purity: Affinity purification
Sequence: LISHLERGEAPWGPDPWDTEILRGISQGGESWIKNEGLVIKQEASEETELHRMPVGGLLRNVSQHFDFKRKALKQTFNLNPNLILRGGMKF
Target: ZNF621
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of lysates from HeLa cells, using ZNF621 Rabbit pAb (A14634) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.