UBE2D3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14640
Article Name: UBE2D3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14640
Supplier Catalog Number: A14640
Alternative Catalog Number: ABB-A14640-100UL,ABB-A14640-20UL,ABB-A14640-500UL,ABB-A14640-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: UBC4/5, UBCH5C, E2(17)KB3, UBE2D3
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 7323
UniProt: P61077
Purity: Affinity purification
Sequence: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTIS
Target: UBE2D3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Immunology Inflammation,NF-kB Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using UBE2D3 Rabbit pAb (A14640) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.