IPO11 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14680
- Images (1)
| Article Name: | IPO11 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A14680 |
| Supplier Catalog Number: | A14680 |
| Alternative Catalog Number: | ABB-A14680-20UL,ABB-A14680-100UL,ABB-A14680-1000UL,ABB-A14680-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | RanBP11, IPO11 |
| Importins, including IPO11, are a members of the karyopherin/importin-beta family of transport receptors (see KPNB1, 602738) that mediate nucleocytoplasmic transport of protein and RNA cargoes (Plafker and Macara, 2000 [PubMed 11032817]). |
| Clonality: | Polyclonal |
| Molecular Weight: | 113kDa |
| NCBI: | 51194 |
| UniProt: | Q9UI26 |
| Purity: | Affinity purification |
| Sequence: | KGIIEGERYPVVMSTYLGVMGRVLLQNTSFFSSLLNEMAHKFNQEMDQLLGNMIEMWVDRMDNITQPERRKLSALALLSLLPSDNSVIQDKFCGIINISVEGLHDVMTEDPETGTYKDCMLMSHLEEPKVTEDEEPPTEQDKRKKMLALKDPVHTVSLQQFIYEKLKAQQEMLGEQGFQSLMETVDTEIVTQLQEFLQGF |
| Target: | IPO11 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using IPO11 Rabbit pAb (A14680) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Product Guarantee and Expert Support
