KDM7A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14692
Article Name: KDM7A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14692
Supplier Catalog Number: A14692
Alternative Catalog Number: ABB-A14692-20UL,ABB-A14692-100UL,ABB-A14692-500UL,ABB-A14692-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Jhdm1d, mKIAA1718, A630082K20Rik, KDM7A
Enables histone H3-methyl-lysine-9 demethylase activity and histone H3-tri/di-methyl-lysine-27 demethylase activity. Involved in histone H3-K27 demethylation, histone H3-K9 demethylation, and positive regulation of transcription, DNA-templated. Predicted to be located in nucleolus and nucleoplasm. Human ortholog(s) of this gene implicated in melanoma. Orthologous to human KDM7A (lysine demethylase 7A).
Clonality: Polyclonal
Molecular Weight: 106kDa
NCBI: 338523
UniProt: Q3UWM4
Purity: Affinity purification
Sequence: WHRHDYTEVDDGSKPVQAGTRAFVKELRSRVFPSADEIIVKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPAFSVMDVERYVGGDKVIDVIDVARQ
Target: Kdm7a
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics & Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of lysates from T-47d cells, using KDM7A Rabbit pAb (A14692) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.