CDH9 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14716
Article Name: CDH9 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14716
Supplier Catalog Number: A14716
Alternative Catalog Number: ABB-A14716-100UL,ABB-A14716-20UL,ABB-A14716-1000UL,ABB-A14716-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CDH9
This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. The extracellular domain consists of 5 subdomains, each containing a cadherin motif, and appears to determine the specificity of the proteins homophilic cell adhesion activity. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins.
Clonality: Polyclonal
Molecular Weight: 89kDa
NCBI: 1007
UniProt: Q9ULB4
Purity: Affinity purification
Sequence: QMLYTLRVDASNTHPDPRFLHLGPFKDTAVVKISVEDIDEPPVFTKVSYLIEVDEDVKEGSIIGQVTAYDPDARNNLIKYS
Target: CDH9
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cadherins,Cytoskeleton,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using CDH9 Rabbit pAb (A14716) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.