EPS8 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14730
- Images (1)
| Article Name: | EPS8 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A14730 |
| Supplier Catalog Number: | A14730 |
| Alternative Catalog Number: | ABB-A14730-100UL,ABB-A14730-20UL,ABB-A14730-500UL,ABB-A14730-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | DFNB102, EPS8 |
| This gene encodes a member of the EPS8 family. This protein contains one PH domain and one SH3 domain. It functions as part of the EGFR pathway, though its exact role has not been determined. Highly similar proteins in other organisms are involved in the transduction of signals from Ras to Rac and growth factor-mediated actin remodeling. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. |
| Clonality: | Polyclonal |
| Molecular Weight: | 92kDa |
| NCBI: | 2059 |
| UniProt: | Q12929 |
| Purity: | Affinity purification |
| Sequence: | MNGHISNHPSSFGMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALR |
| Target: | EPS8 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using EPS8 Rabbit pAb (A14730) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 1s. |
Product Guarantee and Expert Support
