GBX2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14733
- Images (1)
| Article Name: | GBX2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A14733 |
| Supplier Catalog Number: | A14733 |
| Alternative Catalog Number: | ABB-A14733-20UL,ABB-A14733-100UL,ABB-A14733-1000UL,ABB-A14733-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | GBX2 |
| Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in regulation of nervous system development and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including branching involved in blood vessel morphogenesis, nervous system development, and neural crest cell migration. Predicted to be part of chromatin. Predicted to be active in nucleus. |
| Clonality: | Polyclonal |
| Molecular Weight: | 37kDa |
| NCBI: | 2637 |
| UniProt: | P52951 |
| Purity: | Affinity purification |
| Sequence: | MSAAFPPSLMMMQRPLGSSTAFSIDSLIGSPPQPSPGHFVYTGYPMFMPYRPVVLPPPPPPPPALPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEETPPSSGAAGSTTSTGKNRRR |
| Target: | GBX2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Neuroscience,Cardiovascular,Angiogenesis. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using GBX2 Rabbit pAb (A14733) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
