CD239/BCAM Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14747
- Images (1)
| Article Name: | CD239/BCAM Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A14747 |
| Supplier Catalog Number: | A14747 |
| Alternative Catalog Number: | ABB-A14747-20UL,ABB-A14747-100UL,ABB-A14747-1000UL,ABB-A14747-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | AU, LU, CD239, MSK19, CD239/BCAM |
| This gene encodes Lutheran blood group glycoprotein, a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. The protein contains five extracellular immunoglobulin domains, a single transmembrane domain, and a short C-terminal cytoplasmic tail. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease. Polymorphisms in this gene define some of the antigens in the Lutheran system and also the Auberger system. Inactivating variants of this gene result in the recessive Lutheran null phenotype, Lu(a-b-), of the Lutheran blood group. Two transcript variants encoding different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 67kDa |
| NCBI: | 4059 |
| UniProt: | P50895 |
| Purity: | Affinity purification |
| Sequence: | KTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQA |
| Target: | BCAM |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse. ResearchArea: Immunology Inflammation,CDs,Cardiovascular,Blood. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from mouse lung, using CD239/BCAM Rabbit pAb (A14747) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 60s. |
Product Guarantee and Expert Support
